SUPERFAMILY 1.73 HMM library and genome assignments server

  Home > Genomes > Escherichia coli K-12 subMG1655 > gi|16129122|ref|NP_415677.1|

Domain assignment for gi|16129122|ref|NP_415677.1| from Escherichia coli K-12 subMG1655

Domain architecture

Domain assignment details

(show help)

No Significant Hits.

Weak hits

Sequence:  gi|16129122|ref|NP_415677.1|
Domain Number - Region: 225-256
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.00903
Family HNH-motif 0.0067
Further Details:      
 

Protein sequence

External link(s) gi|16129122|ref|NP_415677.1|
Sequence length 277
Comment e14 prophage; 5-methylcytosine-specific restriction endonuclease B [Escherichia coli str. K-12 substr. MG1655]
Sequence 
MHVFDNNGIELKAECSIGEEDGVYGLILESWGPGDRNKDYNIALDYIIERLVDSGVSQVV
VYLASSSVRKHMHSLDERKIHPGEYFTLIGNSPRDIRLKMCGYQAYFSRTGRKEIPSGNR
TKRILINVPGIYSDSFWASIIRGELSELSQPTDDESLLNMRVSKLIKKTLSQPEGSRKPV
EVERLQKVYVRDPMVKAWILQQSKGICENCGKNAPFYLNDGNPYLEVHHVIPLSSGGADT
TDNCVALCPNCHRELHYSKNAKELIEMLYVNINRLQK
Download sequence
Identical sequences P24200
gi|89108004|ref|AP_001784.1| 367968 ER598 MCRA_ECOLI

Jump to [ Top of page · Domain architecture · Domain assignment details ]
Please cite: Gough, J., Karplus, K., Hughey, R. and Chothia, C. (2001). "Assignment of Homology to Genome Sequences using a Library of Hidden Markov Models that Represent all Proteins of Known Structure." J. Mol. Biol., 313(4), 903-919.

Please send feedback, comments or questions to superfamily@mrc-lmb.cam.ac.uk or use the feedback form.

© Copyright 2001-2010 The Medical Research Council and the SUPERFAMILY authors; Derek Wilson, Martin Madera and Julian Gough.